Recombinant Full Length Human GRIN2C Protein, GST-tagged

• Cat.No.: GRIN2C-5665HF
• Product Overview: Human GRIN2C full-length ORF ( AAH59384.1, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 171 amino acids
• Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).
• Molecular Mass: 44 kDa
• AA Sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ]
• Official Symbol: GRIN2C
• Synonyms: GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3; GluN2C; N-methyl D-aspartate receptor subtype 2C; N-methyl-D-aspartate receptor subunit 2C; NR2C
• Gene ID: 2905
• mRNA Refseq: NM_000835
• Protein Refseq: NP_000826
• MIM: 138254
• UniProt ID: Q14957