Recombinant Human GRIN2C Protein, GST-tagged
Cat.No. : | GRIN2C-5346H |
Product Overview : | Human GRIN2C full-length ORF ( AAH59384.1, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). |
Molecular Mass : | 44 kDa |
AA Sequence : | MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ] |
Official Symbol | GRIN2C |
Synonyms | GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3; GluN2C; N-methyl D-aspartate receptor subtype 2C; N-methyl-D-aspartate receptor subunit 2C; NR2C; |
Gene ID | 2905 |
mRNA Refseq | NM_000835 |
Protein Refseq | NP_000826 |
MIM | 138254 |
UniProt ID | Q14957 |
◆ Recombinant Proteins | ||
GRIN2C-5346H | Recombinant Human GRIN2C Protein, GST-tagged | +Inquiry |
GRIN2C-8756H | Recombinant Human GRIN2C protein, His-tagged | +Inquiry |
GRIN2C-29051TH | Recombinant Human GRIN2C, Protein A-tagged | +Inquiry |
GRIN2C-2702R | Recombinant Rat GRIN2C Protein | +Inquiry |
GRIN2C-208HF | Recombinant Full Length Human GRIN2C Protein, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIN2C-5744HCL | Recombinant Human GRIN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN2C Products
Required fields are marked with *
My Review for All GRIN2C Products
Required fields are marked with *
0
Inquiry Basket