Recombinant Human GRIN2B Protein, GST-tagged
Cat.No. : | GRIN2B-5345H |
Product Overview : | Human GRIN2B partial ORF ( NP_000825, 127 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of three different subunits: NR1 (GRIN1), NR2 (GRIN2A, GRIN2B, GRIN2C, or GRIN2D) and NR3 (GRIN3A or GRIN3B). The NR2 subunit acts as the agonist binding site for glutamate. This receptor is the predominant excitatory neurotransmitter receptor in the mammalian brain. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIN2B glutamate receptor, ionotropic, N-methyl D-aspartate 2B [ Homo sapiens ] |
Official Symbol | GRIN2B |
Synonyms | GRIN2B; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; NMDAR2B; glutamate [NMDA] receptor subunit epsilon-2; GluN2B; NR3; glutamate receptor subunit epsilon-2; N-methyl-D-aspartate receptor subunit 3; N-methyl D-aspartate receptor subtype 2B; MRD6; NR2B; hNR3; MGC142178; MGC142180; |
Gene ID | 2904 |
mRNA Refseq | NM_000834 |
Protein Refseq | NP_000825 |
MIM | 138252 |
UniProt ID | Q13224 |
◆ Recombinant Proteins | ||
GRIN2B-2701R | Recombinant Rat GRIN2B Protein | +Inquiry |
GRIN2B-5345H | Recombinant Human GRIN2B Protein, GST-tagged | +Inquiry |
GRIN2B-13535H | Recombinant Human GRIN2B, His-tagged | +Inquiry |
GRIN2B-2546H | Recombinant Human GRIN2B Protein (Tyr1133-Val1484), N-His tagged | +Inquiry |
GRIN2B-2355R | Recombinant Rat GRIN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN2B Products
Required fields are marked with *
My Review for All GRIN2B Products
Required fields are marked with *
0
Inquiry Basket