Recombinant Human GRIN2B protein(1251-1380 aa), C-His-tagged

• Cat.No.: GRIN2B-2848H
• Product Overview: Recombinant Human GRIN2B protein(Q13224)(1251-1380 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1251-1380 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 17.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPD

Gene Information

• Gene Name: GRIN2B glutamate receptor, ionotropic, N-methyl D-aspartate 2B [ Homo sapiens ]
• Official Symbol: GRIN2B
• Synonyms: GRIN2B; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; NMDAR2B; glutamate [NMDA] receptor subunit epsilon-2; GluN2B; NR3; glutamate receptor subunit epsilon-2; N-methyl-D-aspartate receptor subunit 3; N-methyl D-aspartate receptor subtype 2B; MRD6; NR2B; hNR3; MGC142178; MGC142180
• Gene ID: 2904
• mRNA Refseq: NM_000834
• Protein Refseq: NP_000825
• MIM: 138252
• UniProt ID: Q13224