Recombinant Human GRIN2B

• Cat.No.: GRIN2B-29049TH
• Product Overview: Recombinant fragment corresponding to amino acids 127-236 of Human NMDAR2B with a proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of three different subunits: NR1 (GRIN1), NR2 (GRIN2A, GRIN2B, GRIN2C, or GRIN2D) and NR3 (GRIN3A or GRIN3B). The NR2 subunit acts as the agonist binding site for glutamate. This receptor is the predominant excitatory neurotransmitter receptor in the mammalian brain.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Primarily found in the fronto-parieto-temporal cortex and hippocampus pyramidal cells, lower expression in the basal ganglia.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
• Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.

Gene Information

• Gene Name: GRIN2B glutamate receptor, ionotropic, N-methyl D-aspartate 2B [ Homo sapiens ]
• Official Symbol: GRIN2B
• Synonyms: GRIN2B; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; NMDAR2B; glutamate [NMDA] receptor subunit epsilon-2
• Gene ID: 2904
• mRNA Refseq: NM_000834
• Protein Refseq: NP_000825
• MIM: 138252
• Uniprot ID: Q13224
• Chromosome Location: 12p12
• Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
• Function: D2 dopamine receptor binding; N-methyl-D-aspartate selective glutamate receptor activity; beta-catenin binding; cell adhesion molecule binding; drug binding