Recombinant Human GRIK1 protein(291-530 aa), C-His-tagged

• Cat.No.: GRIK1-2748H
• Product Overview: Recombinant Human GRIK1 protein(P39086)(291-530 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-530 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVA

Gene Information

• Gene Name: GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
• Official Symbol: GRIK1
• Synonyms: GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5
• Gene ID: 2897
• mRNA Refseq: NM_000830
• Protein Refseq: NP_000821
• MIM: 138245
• UniProt ID: P39086