Recombinant Human GRIK1 Protein, GST-tagged
Cat.No. : | GRIK1-5336H |
Product Overview : | Human GRIK1 partial ORF ( NP_000821, 331 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ] |
Official Symbol | GRIK1 |
Synonyms | GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5; |
Gene ID | 2897 |
mRNA Refseq | NM_000830 |
Protein Refseq | NP_000821 |
MIM | 138245 |
UniProt ID | P39086 |
◆ Recombinant Proteins | ||
GRIK1-566C | Recombinant Cynomolgus GRIK1 Protein, His-tagged | +Inquiry |
GRIK1-312C | Recombinant Cynomolgus Monkey GRIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK1-2748H | Recombinant Human GRIK1 protein(291-530 aa), C-His-tagged | +Inquiry |
GRIK1-28537TH | Recombinant Human GRIK1 | +Inquiry |
GRIK1-2349R | Recombinant Rat GRIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIK1 Products
Required fields are marked with *
My Review for All GRIK1 Products
Required fields are marked with *
0
Inquiry Basket