Recombinant Human GRIK1 Protein, GST-tagged

• Cat.No.: GRIK1-5336H
• Product Overview: Human GRIK1 partial ORF ( NP_000821, 331 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
• Official Symbol: GRIK1
• Synonyms: GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5
• Gene ID: 2897
• mRNA Refseq: NM_000830
• Protein Refseq: NP_000821
• MIM: 138245
• UniProt ID: P39086