Description :	This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist.
Protein length :	330 amino acids
Conjugation :	HIS
Molecular Weight :	40.000kDa inclusive of tags
Form :	Liquid
Purity :	>90% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Sequence Similarities :	Belongs to the GRB2/sem-5/DRK family.Contains 1 SH2 domain.Contains 2 SH3 domains.

Gene Name	GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ]
Official Symbol	GRAP2
Synonyms	GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona;
Gene ID	9402
mRNA Refseq	NM_004810
Protein Refseq	NP_004801
MIM	604518
Uniprot ID	O75791
Chromosome Location	22q13.2
Pathway	Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem;
Function	SH3/SH2 adaptor activity; protein binding;

RRM2-705H	Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged	+Inquiry
FIS1-2477H	Recombinant Human FIS1, His-tagged	+Inquiry
RAB27A-2479H	Recombinant Human RAB27A, His-tagged	+Inquiry
RAB11A-2480H	Recombinant Human RAB11A, Member RAS Oncogene Family, His-tagged	+Inquiry
ADK-2481H	Recombinant Human Adenosine Kinase, His-tagged	+Inquiry

COA

Cat.No. :	GRAP2-27308TH
Product Overview :	Recombinant full length Human GRAP2 with an N terminal His tag; 350 amino acids with tag, MWt 40.0 kDa.

Recombinant Human GRAP2, His-tagged