Recombinant Full Length Human GRAP2 Protein, GST-tagged

Cat.No. : GRAP2-5318HF
Product Overview : Human GRAP2 full-length ORF ( NP_004801.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 330 amino acids
Description : This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq
Molecular Mass : 64.3 kDa
AA Sequence : MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ]
Official Symbol GRAP2
Synonyms GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2;
Gene ID 9402
mRNA Refseq NM_004810
Protein Refseq NP_004801
MIM 604518
UniProt ID O75791

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRAP2 Products

Required fields are marked with *

My Review for All GRAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon