Recombinant Human GRB2 related adaptor protein 2 Protein, His-tagged
Cat.No. : | GRAP2-3432H |
Product Overview : | Recombinant Human GRAP2 protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-330 aa |
Description : | This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Molecular Mass : | 39 kDa |
AA Sequence : | MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTRHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Concentration : | 1 mg/mL by BCA |
Gene Name | GRAP2 GRB2 related adaptor protein 2 [ Homo sapiens (human) ] |
Official Symbol | GRAP2 |
Synonyms | GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2; |
Gene ID | 9402 |
mRNA Refseq | NM_004810 |
Protein Refseq | NP_004801 |
MIM | 604518 |
UniProt ID | O75791 |
◆ Recombinant Proteins | ||
GRAP2-3911M | Recombinant Mouse GRAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Grap2-1603R | Recombinant Rat Grap2 protein, His & T7-tagged | +Inquiry |
GRAP2-1790R | Recombinant Rhesus Macaque GRAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRAP2-1969R | Recombinant Rhesus monkey GRAP2 Protein, His-tagged | +Inquiry |
GRAP2-7243M | Recombinant Mouse GRAP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAP2-5757HCL | Recombinant Human GRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRAP2 Products
Required fields are marked with *
My Review for All GRAP2 Products
Required fields are marked with *
0
Inquiry Basket