Description :	This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Source :	E. coli
Species :	Human
Tag :	C-His
Protein length :	1-330 aa
Molecular Mass :	39 kDa
AA Sequence :	MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTRHHHHHHHH
Endotoxin :	< 1 EU/μg by LAL
Purity :	> 90% by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer :	Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration :	1 mg/mL by BCA

Gene Name	GRAP2 GRB2 related adaptor protein 2 [ Homo sapiens (human) ]
Official Symbol	GRAP2
Synonyms	GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2;
Gene ID	9402
mRNA Refseq	NM_004810
Protein Refseq	NP_004801
MIM	604518
UniProt ID	O75791