Recombinant Human GPX4 Protein, His-tagged
Cat.No. : | GPX4-37H |
Product Overview : | Recombinant Human GPX4 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. |
Form : | Supplied as a 0.2 μm filtered solution in 30 mM Tris, 300mM NaCl, pH9.0. |
Molecular Mass : | ~21.3KDa |
AA Sequence : | MHHHHHHENLYFQSMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
Endotoxin : | <1EU/ug |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.125 mg/mL |
Gene Name | GPX4 glutathione peroxidase 4 [ Homo sapiens (human) ] |
Official Symbol | GPX4 |
Synonyms | MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx |
Gene ID | 2879 |
mRNA Refseq | NM_001039847 |
Protein Refseq | NP_001034936 |
MIM | 138322 |
UniProt ID | P36969 |
◆ Recombinant Proteins | ||
GPX4-1903P | Recombinant Pongo Pygmaeus GPX4 Protein (1-170 aa), His-SUMO-tagged | +Inquiry |
GPX4-29076TH | Recombinant Human GPX4, His-tagged | +Inquiry |
GPX4-1363H | Recombinant Human GPX4 protein, His-tagged | +Inquiry |
GPX4-29080TH | Recombinant Human GPX4 Protein | +Inquiry |
GPX4-21H | Recombinant Human GPX4 Protein, 170 residues | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX4-308HCL | Recombinant Human GPX4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX4 Products
Required fields are marked with *
My Review for All GPX4 Products
Required fields are marked with *
0
Inquiry Basket