Recombinant Pongo Pygmaeus GPX4 Protein (1-170 aa), His-SUMO-tagged

• Cat.No.: GPX4-1903P
• Product Overview: Recombinant Pongo Pygmaeus (Bornean orangutan) GPX4 Protein (1-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Pongo Pygmaeus
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-170 aa
• Description: Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.0 kDa
• AA Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: GPX4; Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4
• UniProt ID: Q4AEH2