Recombinant Human GPRC5B protein, GST-tagged

• Cat.No.: GPRC5B-1846H
• Product Overview: Recombinant Human GPRC5B protein(293-331 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 293-331 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: HCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GPRC5B G protein-coupled receptor, family C, group 5, member B [ Homo sapiens ]
• Official Symbol: GPRC5B
• Synonyms: GPRC5B; G protein-coupled receptor, family C, group 5, member B; G protein coupled receptor, family C, group 1, member B; G-protein coupled receptor family C group 5 member B; RAIG 2; A-69G12.1; retinoic acid-induced gene 2 protein; retinoic acid responsive gene protein; G protein-coupled receptor, family C, group 1, member B; RAIG2; RAIG-2
• Gene ID: 51704
• mRNA Refseq: NM_016235
• Protein Refseq: NP_057319
• MIM: 605948
• UniProt ID: Q9NZH0