Recombinant Full Length Human G-Protein Coupled Receptor Family C Group 5 Member B(Gprc5B) Protein, His-Tagged

• Cat.No.: RFL406HF
• Product Overview: Recombinant Full Length Human G-protein coupled receptor family C group 5 member B(GPRC5B) Protein (Q9NZH0) (29-403aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Homo sapiens (Human)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (29-403)
• AA Sequence: ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKE KKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVR RLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDM VLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWN DPTLAITLAASGWVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPR AYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGG TIPTAPPSHTGRHLW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: GPRC5B
• Synonyms: GPRC5B; RAIG2; G-protein coupled receptor family C group 5 member B; A-69G12.1; Retinoic acid-induced gene 2 protein; RAIG-2
• UniProt ID: Q9NZH0