Recombinant Human GPER Protein

• Cat.No.: GPER-5154H
• Product Overview: Human GPER full-length ORF (NP_001496.1) recombinant protein without tag.

Specification

• Description: This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Form: Liquid
• Molecular Mass: 42.2 kDa
• AA Sequence: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: GPER G protein-coupled estrogen receptor 1 [ Homo sapiens ]
• Official Symbol: GPER
• Synonyms: GPER; G protein-coupled estrogen receptor 1; CMKRL2, G protein coupled receptor 30, GPR30; G-protein coupled estrogen receptor 1; CEPR; DRY12; FEG 1; GPCR Br; LERGU; LERGU2; LyGPR; mER; heptahelix receptor; chemokine receptor-like 2; IL8-related receptor DRY12; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; chemoattractant receptor-like 2; leucine rich protein in GPR30 3UTR; lymphocyte-derived G-protein coupled receptor; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; FEG-1; GPR30; CMKRL2; GPCR-Br; MGC99678
• Gene ID: 2852
• mRNA Refseq: NM_001039966
• Protein Refseq: NP_001035055
• MIM: 601805
• UniProt ID: Q99527