Recombinant Human GPER Protein, GST-tagged

Cat.No. : GPER-5230H
Product Overview : Human GPR30 full-length ORF ( NP_001496.1, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 68.6 kDa
AA Sequence : MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPER G protein-coupled estrogen receptor 1 [ Homo sapiens ]
Official Symbol GPER
Synonyms GPER; G protein-coupled estrogen receptor 1; CMKRL2, G protein coupled receptor 30, GPR30; G-protein coupled estrogen receptor 1; CEPR; DRY12; FEG 1; GPCR Br; LERGU; LERGU2; LyGPR; mER; heptahelix receptor; chemokine receptor-like 2; IL8-related receptor DRY12; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; chemoattractant receptor-like 2; leucine rich protein in GPR30 3UTR; lymphocyte-derived G-protein coupled receptor; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; FEG-1; GPR30; CMKRL2; GPCR-Br; MGC99678;
Gene ID 2852
mRNA Refseq NM_001039966
Protein Refseq NP_001035055
MIM 601805
UniProt ID Q99527

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPER Products

Required fields are marked with *

My Review for All GPER Products

Required fields are marked with *

0

Inquiry Basket

cartIcon