Recombinant Human GNRHR Protein

• Cat.No.: GNRHR-5099H
• Product Overview: Human GNRHR full-length ORF (ADR83139.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5 region and multiple polyA signals in the 3 region have been identified for this gene. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 36.1 kDa
• AA Sequence: MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GNRHR gonadotropin-releasing hormone receptor [ Homo sapiens ]
• Official Symbol: GNRHR
• Synonyms: GNRHR; gonadotropin-releasing hormone receptor; GRHR; LHRHR; gnRH-R; gnRH receptor; luliberin receptor; type I GnRH receptor; leutinizing-releasing hormone receptor; leutinizing hormone releasing horomone receptor; gonadotropin-releasing hormone (type 1) receptor 1; LRHR; GNRHR1
• Gene ID: 2798
• mRNA Refseq: NM_000406
• Protein Refseq: NP_000397
• MIM: 138850
• UniProt ID: P30968