Recombinant Human GNRHR Protein

Cat.No. : GNRHR-5099H
Product Overview : Human GNRHR full-length ORF (ADR83139.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5 region and multiple polyA signals in the 3 region have been identified for this gene. [provided by RefSeq
Form : Liquid
Molecular Mass : 36.1 kDa
AA Sequence : MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GNRHR gonadotropin-releasing hormone receptor [ Homo sapiens ]
Official Symbol GNRHR
Synonyms GNRHR; gonadotropin-releasing hormone receptor; GRHR; LHRHR; gnRH-R; gnRH receptor; luliberin receptor; type I GnRH receptor; leutinizing-releasing hormone receptor; leutinizing hormone releasing horomone receptor; gonadotropin-releasing hormone (type 1) receptor 1; LRHR; GNRHR1;
Gene ID 2798
mRNA Refseq NM_000406
Protein Refseq NP_000397
MIM 138850
UniProt ID P30968

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNRHR Products

Required fields are marked with *

My Review for All GNRHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon