Recombinant Human GNB2L1 protein, His-tagged

• Cat.No.: GNB2L1-2655H
• Product Overview: Recombinant Human GNB2L1 protein(131-317 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 131-317 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GNB2L1 guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [ Homo sapiens ]
• Official Symbol: GNB2L1
• Synonyms: GNB2L1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide-binding protein subunit beta-2-like 1; Gnb2 rs1; H12.3; RACK1; Receptor for Activated C Kinase 1; lung cancer oncogene 7; proliferation-inducing gene 21; human lung cancer oncogene 7 protein; receptor of activated protein kinase C 1; cell proliferation-inducing gene 21 protein; guanine nucleotide-binding protein subunit beta-like protein 12.3; protein homologous to chicken B complex protein, guanine nucleotide binding; HLC-7; PIG21; Gnb2-rs1
• Gene ID: 10399
• mRNA Refseq: NM_006098
• Protein Refseq: NP_006089
• MIM: 176981
• UniProt ID: P63244