Recombinant Human GMPR2, His-tagged

• Cat.No.: GMPR2-28148TH
• Product Overview: Recombinant full length Human GMPR2 (amino acids 1-348) with an N terminal His tag (368 amino acids with the tag).

Specification

• Description: Guanosine monophosphate reductase (GMPR) Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP.
• Protein length: 348 amino acids
• Conjugation: HIS
• Molecular Weight: 40.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

Gene Information

• Gene Name: GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens ]
• Official Symbol: GMPR2
• Synonyms: GMPR2; guanosine monophosphate reductase 2; GMP reductase 2
• Gene ID: 51292
• mRNA Refseq: NM_001002000
• Protein Refseq: NP_001002000
• MIM: 610781
• Uniprot ID: Q9P2T1
• Chromosome Location: 14q11.2
• Pathway: Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem
• Function: GMP reductase activity; metal ion binding; oxidoreductase activity