Recombinant Human GMPR2 Protein, GST-tagged

• Cat.No.: GMPR2-5022H
• Product Overview: Human GMPR2 full-length ORF ( NP_001002000.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.3 kDa
• AA Sequence: MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens ]
• Official Symbol: GMPR2
• Synonyms: GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; guanosine monophosphate reductase isolog; guanosine 5-monophosphate oxidoreductase 2; MGC830; MGC15084
• Gene ID: 51292
• mRNA Refseq: NM_001002000
• Protein Refseq: NP_001002000
• MIM: 610781
• UniProt ID: Q9P2T1