Recombinant Human GMPR2 Protein, GST-tagged
Cat.No. : | GMPR2-5022H |
Product Overview : | Human GMPR2 full-length ORF ( NP_001002000.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
Molecular Mass : | 64.3 kDa |
AA Sequence : | MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens ] |
Official Symbol | GMPR2 |
Synonyms | GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; guanosine monophosphate reductase isolog; guanosine 5-monophosphate oxidoreductase 2; MGC830; MGC15084; |
Gene ID | 51292 |
mRNA Refseq | NM_001002000 |
Protein Refseq | NP_001002000 |
MIM | 610781 |
UniProt ID | Q9P2T1 |
◆ Recombinant Proteins | ||
GMPR2-5420HF | Recombinant Full Length Human GMPR2 Protein, GST-tagged | +Inquiry |
GMPR2-1013H | Recombinant Human GMPR2 | +Inquiry |
GMPR2-28148TH | Recombinant Human GMPR2, His-tagged | +Inquiry |
GMPR2-3751M | Recombinant Mouse GMPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GMPR2-788H | Recombinant Human Guanosine Monophosphate Reductase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR2-5874HCL | Recombinant Human GMPR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMPR2 Products
Required fields are marked with *
My Review for All GMPR2 Products
Required fields are marked with *
0
Inquiry Basket