Recombinant Human GIMAP2 Protein, GST-tagged

• Cat.No.: GIMAP2-4898H
• Product Overview: Human GIMAP2 full-length ORF ( NP_056475.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.4 kDa
• AA Sequence: MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GIMAP2 GTPase, IMAP family member 2 [ Homo sapiens ]
• Official Symbol: GIMAP2
• Synonyms: GIMAP2; GTPase, IMAP family member 2; GTPase IMAP family member 2; DKFZp586D0824; HIMAP2; IMAP2; immunity associated protein 2; immunity-associated protein 2; MGC24275
• Gene ID: 26157
• mRNA Refseq: NM_015660
• Protein Refseq: NP_056475
• MIM: 608085
• UniProt ID: Q9UG22