Recombinant Full Length Human GIMAP2 Protein, GST-tagged

Cat.No. : GIMAP2-5256HF
Product Overview : Human GIMAP2 full-length ORF ( NP_056475.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 64.4 kDa
Protein length : 337 amino acids
AA Sequence : MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GIMAP2 GTPase, IMAP family member 2 [ Homo sapiens ]
Official Symbol GIMAP2
Synonyms GIMAP2; GTPase, IMAP family member 2; GTPase IMAP family member 2; DKFZp586D0824; HIMAP2; IMAP2; immunity associated protein 2; immunity-associated protein 2; MGC24275;
Gene ID 26157
mRNA Refseq NM_015660
Protein Refseq NP_056475
MIM 608085
UniProt ID Q9UG22

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GIMAP2 Products

Required fields are marked with *

My Review for All GIMAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon