Recombinant Human GDF15 protein, His-tagged
Cat.No. : | GDF15-284H |
Product Overview : | Recombinant Human GDF15 protein is produced by E.coli expression system. This protein is fused with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Leu30-Ile308 |
Form : | PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin 300. |
Molecular Mass : | 38 kDa |
AA Sequence : | LSLAEASRASFPGPSELHSEDSRFRELPKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLPLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95 % |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Storage Buffer : | PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin 300. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | GDF15 growth differentiation factor 15 [ Homo sapiens ] |
Official Symbol | GDF15 |
Synonyms | GDF15; MIC 1; MIC1; NAG 1; PDF; PLAB; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; MIC-1; NAG-1; GDF-15; |
Gene ID | 9518 |
mRNA Refseq | NM_004864 |
Protein Refseq | NP_004855 |
MIM | 605312 |
UniProt ID | Q99988 |
◆ Recombinant Proteins | ||
GDF15-2158R | Recombinant Rat GDF15 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gdf15-392M | Recombinant Mouse Gdf15 protein, His-tagged | +Inquiry |
GDF15-6285M | Recombinant Mouse Gdf15 protein, His-tagged | +Inquiry |
GDF15-4822H | Recombinant Human GDF15 Protein, GST-tagged | +Inquiry |
GDF15-3309H | Recombinant Human GDF15 Protein (Ala197-Ile308), His tagged | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF15-2705HCL | Recombinant Human GDF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF15 Products
Required fields are marked with *
My Review for All GDF15 Products
Required fields are marked with *
0
Inquiry Basket