Active Recombinant Human GDF15 Protein
Cat.No. : | GDF15-4821H |
Product Overview : | Human GDF15 (Q99988) partial recombinant protein expressed in CHO cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Description : | Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM |
Form : | Lyophilized |
Bio-activity : | Determined by a cell inhibition assay using DU-145 cells. The expected ED50 for this effect is 1.0-2.0 μg/mL. |
AA Sequence : | ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Endotoxin : | <0.1 ng/μg (<1 EU/μg) |
Purity : | 98% |
Applications : | Functional Study SDS-PAGE |
Usage : | SDS-PAGE Activity assay The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20 centigrade to -80 centigrade. |
Storage Buffer : | Lyophilized from 10mM Sodium Citrate, pH 3.0. |
Gene Name | GDF15 growth differentiation factor 15 [ Homo sapiens ] |
Official Symbol | GDF15 |
Synonyms | GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15; |
Gene ID | 9518 |
mRNA Refseq | NM_004864 |
Protein Refseq | NP_004855 |
MIM | 605312 |
UniProt ID | Q99988 |
◆ Recombinant Proteins | ||
GDF15-946H | Recombinant Human GDF15 Protein, His-tagged | +Inquiry |
GDF15-4821H | Active Recombinant Human GDF15 Protein | +Inquiry |
Gdf15-393M | Active Recombinant Mouse Gdf15 protein | +Inquiry |
GDF15-101H | Recombinant Human GDF15 Protein, Ala197-Ile308, N-hFc tagged, Biotinylated | +Inquiry |
GDF15-4822H | Recombinant Human GDF15 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF15-2705HCL | Recombinant Human GDF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF15 Products
Required fields are marked with *
My Review for All GDF15 Products
Required fields are marked with *
0
Inquiry Basket