Recombinant Human GDF15 Protein
Cat.No. : | GDF15-106H |
Product Overview : | Recombinant Human GDF15 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Growth differentiation factor 15 (GDF-15) is a member of the transforming growth factor beta (TGF-β) family and is made by the placenta and cardiovascular tissues. GDF-15 regulates inflammatory and apoptotic pathways during cellular stress and injury. GDF-15 is emerging as a biomarker of early heart disease, such that increased levels of circulating GDF-15 are associated with an increased risk of developing heart failure. The GDF-15 D variant has a Histidine to an Aspartate substitution at amino acid position 7. |
Source : | E. coli |
Species : | Human |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 12.4/24.8 kDa (113/226 aa) |
AA Sequence : | MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | GDF15 growth differentiation factor 15 [ Homo sapiens (human) ] |
Official Symbol | GDF15 |
Synonyms | GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15; |
Gene ID | 9518 |
mRNA Refseq | NM_004864 |
Protein Refseq | NP_004855 |
MIM | 605312 |
UniProt ID | Q99988 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GDF15 Products
Required fields are marked with *
My Review for All GDF15 Products
Required fields are marked with *
0
Inquiry Basket