Recombinant Human GABRB3 protein, GST-tagged

• Cat.No.: GABRB3-3749H
• Product Overview: Recombinant Human GABRB3 protein(371-426 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 371-426 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ]
• Official Symbol: GABRB3
• Synonyms: GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; GABA(A) receptor; beta 3; GABA(A) receptor, beta 3; GABAA receptor beta-3 subunit; GABA(A) receptor beta-3 subunit; GABA-alpha receptor beta-2 subunit; ECA5; MGC9051
• Gene ID: 2562
• mRNA Refseq: NM_000814
• Protein Refseq: NP_000805
• UniProt ID: P28472