Recombinant Human GABRB3

• Cat.No.: GABRB3-28089TH
• Product Overview: Recombinant fragment corresponding to amino acids 26-135 of Human GABA A Receptor beta 3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGM NIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN LTLDNRVADQLWVPDTYFLNDKKSFVHGVT
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily.

Gene Information

• Gene Name: GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ]
• Official Symbol: GABRB3
• Synonyms: GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3
• Gene ID: 2562
• mRNA Refseq: NM_021912
• Protein Refseq: NP_068712
• Uniprot ID: P28472
• Chromosome Location: 15q11.2-q12
• Pathway: GABA A receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Ion channel transport, organism-specific biosystem
• Function: GABA-A receptor activity; chloride channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity