Recombinant Human FZD10 Protein, GST-tagged

• Cat.No.: FZD10-4590H
• Product Overview: Human FZD10 partial ORF ( NP_009128.1, 96 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer. [provided by RefSeq
• Molecular Mass: 35.42 kDa
• AA Sequence: TEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FZD10 frizzled family receptor 10 [ Homo sapiens ]
• Official Symbol: FZD10
• Synonyms: FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10, frizzled 10, seven transmembrane spanning receptor, frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10
• Gene ID: 11211
• mRNA Refseq: NM_007197
• Protein Refseq: NP_009128
• MIM: 606147
• UniProt ID: Q9ULW2