Recombinant Human frizzled class receptor 10 Protein, His&Fc tagged

• Cat.No.: FZD10-13H
• Product Overview: Recombinant human Frizzled-10 (21-225aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: 21-225aa
• Description: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
• Tag: C-His&Fc
• Form: Liquid
• Molecular Mass: 50 kDa
• AA Sequence: ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKR
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: FZD10 frizzled class receptor 10 [ Homo sapiens (human) ]
• Official Symbol: FZD10
• Synonyms: FZD10; frizzled class receptor 10; Fz10; FzE7; CD350; FZ-10; hFz10; frizzled-10; frizzled 10, seven transmembrane spanning receptor; frizzled family receptor 10; frizzled homolog 10
• Gene ID: 11211
• mRNA Refseq: NM_007197
• Protein Refseq: NP_009128
• MIM: 606147
• UniProt ID: Q9ULW2