Recombinant Human FUCA1

• Cat.No.: FUCA1-28956TH
• Product Overview: Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag. P04066,

Specification

• Description: The protein encoded by this gene is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. Mutations in this gene are associated with fucosidosis (FUCA1D), which is an autosomal recessive lysosomal storage disease. A pseudogene of this locus is present on chr 2.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
• Sequence Similarities: Belongs to the glycosyl hydrolase 29 family.
• Tag: Non

Gene Information

• Gene Name: FUCA1 fucosidase, alpha-L- 1, tissue [ Homo sapiens ]
• Official Symbol: FUCA1
• Synonyms: FUCA1; fucosidase, alpha-L- 1, tissue; tissue alpha-L-fucosidase
• Gene ID: 2517
• mRNA Refseq: NM_000147
• Protein Refseq: NP_000138
• MIM: 612280
• Uniprot ID: P04066
• Chromosome Location: 1p34
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem
• Function: alpha-L-fucosidase activity; cation binding; hydrolase activity, acting on glycosyl bonds; sugar binding