Recombinant Human FNDC4 protein, T7/His-tagged

Cat.No. : FNDC4-121H
Product Overview : Recombinant human FNDC4 cDNA (45 - 167aa, derived from BC032725) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 45-167 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFDRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQ RVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human FNDC4 functional study using recombinant FNDC4 protein mediated intracellular delivery.2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ]
Official Symbol FNDC4
Synonyms FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1
Gene ID 64838
mRNA Refseq NM_022823
Protein Refseq NP_073734
MIM 611905
UniProt ID Q9H6D8
Chromosome Location 2p23.3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FNDC4 Products

Required fields are marked with *

My Review for All FNDC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon