Recombinant Full Length Human FNDC4 Protein, GST-tagged
Cat.No. : | FNDC4-5007HF |
Product Overview : | Human FNDC4 full-length ORF ( NP_073734.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 234 amino acids |
Description : | FNDC4 (Fibronectin Type III Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is FNDC5. |
Molecular Mass : | 51.6 kDa |
AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ] |
Official Symbol | FNDC4 |
Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1; |
Gene ID | 64838 |
mRNA Refseq | NM_022823 |
Protein Refseq | NP_073734 |
MIM | 611905 |
UniProt ID | Q9H6D8 |
◆ Recombinant Proteins | ||
FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25848BF | Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged | +Inquiry |
FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fndc4-3064M | Recombinant Mouse Fndc4 Protein, Myc/DDK-tagged | +Inquiry |
FNDC4-4408H | Recombinant Human FNDC4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
0
Inquiry Basket