Recombinant Full Length Human FNDC4 Protein, GST-tagged

• Cat.No.: FNDC4-5007HF
• Product Overview: Human FNDC4 full-length ORF ( NP_073734.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 234 amino acids
• Description: FNDC4 (Fibronectin Type III Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is FNDC5.
• Molecular Mass: 51.6 kDa
• AA Sequence: MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ]
• Official Symbol: FNDC4
• Synonyms: FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1
• Gene ID: 64838
• mRNA Refseq: NM_022823
• Protein Refseq: NP_073734
• MIM: 611905
• UniProt ID: Q9H6D8