Recombinant Human FCN2 protein, His-tagged

• Cat.No.: FCN2-4411H
• Product Overview: Recombinant Human FCN2 protein(Q15485)(26-313aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.4 kDa
• Protein length: 26-313aa
• AA Sequence: LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ]
• Official Symbol: FCN2
• Synonyms: FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37
• Gene ID: 2220
• mRNA Refseq: NM_004108
• Protein Refseq: NP_004099
• MIM: 601624
• UniProt ID: Q15485