Recombinant Human FCGRT protein, Myc/DDK-tagged

Cat.No. : FCGRT-01H
Product Overview : Recombinant Human FCGRT protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Transmembrane.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 39.6 kDa
AA Sequence : myc-FLAG tag
Product-Related Proteins : TA50011-100
LC427768
RC227329
Purity : > 80%
Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL
Gene Name FCGRT Fc gamma receptor and transporter [ Homo sapiens (human) ]
Official Symbol FCGRT
Synonyms alpha-chain; FCRN
Gene ID 2217
mRNA Refseq NM_001136019
Protein Refseq NP_001129491
MIM 601437
UniProt ID P55899

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCGRT Products

Required fields are marked with *

My Review for All FCGRT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon