Recombinant Human FCGR3B Protein, His-tagged
Cat.No. : | FCGR3B-549H |
Product Overview : | Recombinant human FCGR3B protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 233 |
Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1. |
Form : | Lyophilized |
AA Sequence : | MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens (human) ] |
Official Symbol | FCGR3B |
Synonyms | FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; |
Gene ID | 2215 |
mRNA Refseq | NM_000570 |
Protein Refseq | NP_000561 |
MIM | 610665 |
UniProt ID | O75015 |
◆ Recombinant Proteins | ||
FCGR3B-4111H | Recombinant Human FCGR3B Protein (Met1-Ser200), C-His tagged | +Inquiry |
FCGR3B-226H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
FCGR3B-3869HB | Active Recombinant Human FCGR3B protein, Biotinylated | +Inquiry |
FCGR3B-314H | Active Recombinant Human FCGR3B Protein (NA1) (Gly 17 - Ser 200), His-tagged | +Inquiry |
FCGR3B-2459H | Recombinant Human FCGR3B Protein (Thr20-Gln208), C-His-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3B-001HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
FCGR3B-3055HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR3B Products
Required fields are marked with *
My Review for All FCGR3B Products
Required fields are marked with *
0
Inquiry Basket