Recombinant Human FCGR3B protein(21-100 aa), C-His-tagged

• Cat.No.: FCGR3B-2478H
• Product Overview: Recombinant Human FCGR3B protein(O75015)(21-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-100 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPV

Gene Information

• Gene Name: FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ]
• Official Symbol: FCGR3B
• Synonyms: FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb
• Gene ID: 2215
• mRNA Refseq: NM_000570
• Protein Refseq: NP_000561
• MIM: 610665
• UniProt ID: O75015