Recombinant Human FBXW8 Protein, GST-tagged

• Cat.No.: FBXW8-3977H
• Product Overview: Human FBXW8 partial ORF ( NP_699179, 499 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXW8 F-box and WD repeat domain containing 8 [ Homo sapiens ]
• Official Symbol: FBXW8
• Synonyms: FBXW8; F-box and WD repeat domain containing 8; F box and WD 40 domain protein 8 , F box only protein 29 , FBXO29; F-box/WD repeat-containing protein 8; FBW6; FBW8; FBX29; F-box only protein 29; F-box and WD-40 domain protein 8; F-box and WD-40 domain-containing protein 8; FBXW6; FBXO29; MGC33534
• Gene ID: 26259
• mRNA Refseq: NM_012174
• Protein Refseq: NP_036306
• MIM: 609073
• UniProt ID: Q8N3Y1