Recombinant Human FAM3D Protein, His-tagged

Cat.No. : FAM3D-365H
Product Overview : Recombinant Human FAM3D fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Form : Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Molecular Mass : 23.12 kDa
AA Sequence : YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name FAM3D family with sequence similarity 3, member D [ Homo sapiens ]
Official Symbol FAM3D
Synonyms FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7;
Gene ID 131177
mRNA Refseq NM_138805
Protein Refseq NP_620160
MIM 608619
UniProt ID Q96BQ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM3D Products

Required fields are marked with *

My Review for All FAM3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon