Recombinant Human FAM3D Protein, His-tagged

• Cat.No.: FAM3D-3755H
• Product Overview: Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 26-224 a.a.
• Description: FAM3D (Family With Sequence Similarity 3 Member D) is a Protein Coding gene. Diseases associated with FAM3D include Narcolepsy. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3A.
• Form: Liquid
• Molecular Mass: 23.1 kDa
• AA Sequence: GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
• Applications: SDS-PAGE
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 25 mM Tris, 150 mM NaCl, pH 7.5 without preservative.

Gene Information

• Gene Name: FAM3D family with sequence similarity 3, member D [ Homo sapiens ]
• Official Symbol: FAM3D
• Synonyms: FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7
• Gene ID: 131177
• mRNA Refseq: NM_138805
• Protein Refseq: NP_620160
• MIM: 608619
• UniProt ID: Q96BQ1