Recombinant Human FAM3D Protein, His-tagged

Cat.No. : FAM3D-3755H
Product Overview : Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-224 a.a.
Description : FAM3D (Family With Sequence Similarity 3 Member D) is a Protein Coding gene. Diseases associated with FAM3D include Narcolepsy. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3A.
Form : Liquid
Molecular Mass : 23.1 kDa
AA Sequence : GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
Applications : SDS-PAGE
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 25 mM Tris, 150 mM NaCl, pH 7.5 without preservative.
Gene Name FAM3D family with sequence similarity 3, member D [ Homo sapiens ]
Official Symbol FAM3D
Synonyms FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7;
Gene ID 131177
mRNA Refseq NM_138805
Protein Refseq NP_620160
MIM 608619
UniProt ID Q96BQ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM3D Products

Required fields are marked with *

My Review for All FAM3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon