Recombinant Human F9 protein, His-KSI-tagged

• Cat.No.: F9-1299H
• Product Overview: Recombinant Human F9 protein(P00740)(144-239aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 144-239aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: FCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFP

Gene Information

• Gene Name: F9 coagulation factor IX [ Homo sapiens ]
• Official Symbol: F9
• Synonyms: F9; coagulation factor IX; Christmas disease; Factor IX; FIX; hemophilia B; plasma thromboplastic component; F9 p22; FIX F9; factor 9; factor IX F9; serine protease; Christmas factor; plasma thromboplastin component; P19; PTC; HEMB; THPH8; MGC129641; MGC129642
• Gene ID: 2158
• mRNA Refseq: NM_000133
• Protein Refseq: NP_000124
• MIM: 300746
• UniProt ID: P00740