Recombinant Human ESR2 protein, His-tagged

• Cat.No.: ESR2-2872H
• Product Overview: Recombinant Human ESR2 protein(Q92731)(2-323aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-323aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.8 kDa
• AA Sequence: DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
• Purity: ＞85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ]
• Official Symbol: ESR2
• Synonyms: ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; estrogen receptor beta 4; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; nuclear receptor subfamily 3 group A member 2; ESRB; ESTRB; ER-BETA; ESR-BETA
• Gene ID: 2100
• mRNA Refseq: NM_001040275
• Protein Refseq: NP_001035365
• MIM: 601663
• UniProt ID: Q92731