Recombinant Human ESR2 Protein, GST-tagged

• Cat.No.: ESR2-3506H
• Product Overview: Human ESR2 full-length ORF ( AAH24181, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61.27 kDa
• AA Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPRCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ]
• Official Symbol: ESR2
• Synonyms: ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; estrogen receptor beta 4; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; nuclear receptor subfamily 3 group A member 2; ESRB; ESTRB; ER-BETA; ESR-BETA
• Gene ID: 2100
• mRNA Refseq: NM_001040275
• Protein Refseq: NP_001035365
• MIM: 601663
• UniProt ID: Q92731