Recombinant Human EREG

• Cat.No.: EREG-28692TH
• Product Overview: Recombinant full length mature Human EREG with N terminal Methionine; 50aa, 6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 49 amino acids
• Description: Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors.
• Molecular Weight: 6.000kDa
• Tissue specificity: In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.
• Biological activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is500,000 units/mg.
• Form: Lyophilised:It is recommended to reconstitute in sterile Ultra pure water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
• Purity: by SDS-PAGE
• Storage buffer: pH: 7.40Constituents:PBS, 0.76% Sodium chloride
• Storage: Please see Notes section
• Sequences of amino acids: MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
• Sequence Similarities: Contains 1 EGF-like domain.

Gene Information

• Gene Name: EREG epiregulin [ Homo sapiens ]
• Official Symbol: EREG
• Synonyms: EREG; epiregulin; proepiregulin; ER
• Gene ID: 2069
• mRNA Refseq: NM_001432
• Protein Refseq: NP_001423
• MIM: 602061
• Uniprot ID: O14944
• Chromosome Location: 4q21.21
• Pathway: ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; ErbB4 signaling events, organism-specific biosystem
• Function: epidermal growth factor receptor binding; epidermal growth factor receptor binding; growth factor activity; protein binding