Active Recombinant Human EREG Protein (50 aa)
Cat.No. : | EREG-125E |
Product Overview : | Recombinant Human EREG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 50 |
Description : | Epiregulin is a member of the EGF family of growth factors which includes, among others, epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, amphiregulin (ARG), HB (heparin-binding)-EGF, betacellulin, and the various heregulins. It is expressed mainly in the placenta and peripheral blood leukocytes and in certain carcinomas of the bladder, lung, kidney and colon. Epiregulin stimulates the proliferation of keratinocytes, hepatocytes, fibroblasts and vascular smooth muscle cells. It also inhibits the growth of several tumor-derived epithelial cell lines. Human Epiregulin is initially synthesized as a glycosylated 19.0 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a 6.0 kDa mature secreted sequence. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is ≤ 2.0 ng/mL, corresponding to a specific activity of ≥ 5 × 10^5 units/mg. |
Molecular Mass : | Approximately 6.0 KDa, a single non-glycosylated polypeptide chain containing 50 amino acids. |
AA Sequence : | MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
Endotoxin : | Less than 1 EU/mg of rHuEREG as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 130mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | EREG epiregulin [ Homo sapiens ] |
Official Symbol | EREG |
Synonyms | EREG; epiregulin; proepiregulin; ER; |
Gene ID | 2069 |
mRNA Refseq | NM_001432 |
Protein Refseq | NP_001423 |
MIM | 602061 |
UniProt ID | O14944 |
◆ Recombinant Proteins | ||
Ereg-198M | Recombinant Mouse Epiregulin | +Inquiry |
EREG-3465H | Recombinant Human EREG Protein, GST-tagged | +Inquiry |
EREG-28692TH | Recombinant Human EREG | +Inquiry |
EREG-004H | Active Recombinant Human EREG Protein | +Inquiry |
EREG-235H | Recombinant Human EREG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
0
Inquiry Basket