Recombinant Human EPO, StrepII-tagged

• Cat.No.: EPO-252H
• Product Overview: Purified, full-length human recombinant EPO or Erythropoietin protein (amino acids 28-193, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.4 kDa. (Accession NP_000790.2; UniProt P01588)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 28-193, 166 a.a.
• Description: Erythropoietin (EPO) is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHV DKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: EPO erythropoietin [ Homo sapiens ]
• Official Symbol: EPO
• Synonyms: EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142
• Gene ID: 2056
• mRNA Refseq: NM_000799
• Protein Refseq: NP_000790
• MIM: 133170
• UniProt ID: P01588
• Chromosome Location: 7q21
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem
• Function: erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity