Recombinant Human EPO, StrepII-tagged
Cat.No. : | EPO-252H |
Product Overview : | Purified, full-length human recombinant EPO or Erythropoietin protein (amino acids 28-193, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.4 kDa. (Accession NP_000790.2; UniProt P01588) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 28-193, 166 a.a. |
Description : | Erythropoietin (EPO) is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHV DKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | EPO erythropoietin [ Homo sapiens ] |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
MIM | 133170 |
UniProt ID | P01588 |
Chromosome Location | 7q21 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; |
Function | erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity; |
◆ Recombinant Proteins | ||
Epo-104C | Recombinant Canine Erythropoietin | +Inquiry |
EPO-1203P | Recombinant Pig EPO Protein, His-tagged | +Inquiry |
EPO-111H | Active Recombinant Human EPO, HIgG1 Fc-tagged | +Inquiry |
EPO-4401HF | Recombinant Full Length Human EPO Protein, GST-tagged | +Inquiry |
Epo-1433M | Recombinant Mouse Epo Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
0
Inquiry Basket