Recombinant Human EOMES Protein, GST-tagged

Cat.No. : EOMES-3344H
Product Overview : Human EOMES partial ORF ( NP_005433, 547 a.a. - 645 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Molecular Mass : 36.63 kDa
AA Sequence : PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EOMES eomesodermin [ Homo sapiens ]
Official Symbol EOMES
Synonyms EOMES; eomesodermin; eomesodermin (Xenopus laevis) homolog; eomesodermin homolog; T box brain2; TBR2; TBR-2; T-brain-2; T-box brain2; t box, brain, 2; T-box brain protein 2;
Gene ID 8320
mRNA Refseq NM_005442
Protein Refseq NP_005433
MIM 604615
UniProt ID O95936

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EOMES Products

Required fields are marked with *

My Review for All EOMES Products

Required fields are marked with *

0

Inquiry Basket

cartIcon