Recombinant Human EOMES Protein, GST-tagged

• Cat.No.: EOMES-3344H
• Product Overview: Human EOMES partial ORF ( NP_005433, 547 a.a. - 645 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EOMES eomesodermin [ Homo sapiens ]
• Official Symbol: EOMES
• Synonyms: EOMES; eomesodermin; eomesodermin (Xenopus laevis) homolog; eomesodermin homolog; T box brain2; TBR2; TBR-2; T-brain-2; T-box brain2; t box, brain, 2; T-box brain protein 2
• Gene ID: 8320
• mRNA Refseq: NM_005442
• Protein Refseq: NP_005433
• MIM: 604615
• UniProt ID: O95936