Recombinant Human EOMES protein, GST-tagged

• Cat.No.: EOMES-301271H
• Product Overview: Recombinant Human EOMES (575-676 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met575-Met676
• AA Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EOMES eomesodermin [ Homo sapiens ]
• Official Symbol: EOMES
• Synonyms: EOMES; eomesodermin; eomesodermin (Xenopus laevis) homolog; eomesodermin homolog; T box brain2; TBR2; TBR-2; T-brain-2; T-box brain2; t box, brain, 2; T-box brain protein 2
• Gene ID: 8320
• mRNA Refseq: NM_005442
• Protein Refseq: NP_005433
• MIM: 604615
• UniProt ID: O95936