Recombinant Human ENSA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ENSA-1710H
• Product Overview: ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 15.1 kDa
• AA Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSVLLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ENSA endosulfine alpha [ Homo sapiens (human) ]
• Official Symbol: ENSA
• Synonyms: ENSA; endosulfine alpha; alpha-endosulfine; ARPP 19e; MGC4319; MGC8394; MGC78563; ARPP-19e
• Gene ID: 2029
• mRNA Refseq: NM_207042
• Protein Refseq: NP_996925
• MIM: 603061
• UniProt ID: O43768