Recombinant Human EMP3 Protein, GST-tagged

Cat.No. : EMP3-3288H
Product Overview : Human EMP3 full-length ORF ( AAH09718, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 43.67 kDa
AA Sequence : MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMP3 epithelial membrane protein 3 [ Homo sapiens ]
Official Symbol EMP3
Synonyms EMP3; epithelial membrane protein 3; YMP; EMP-3; HNMP-1; hematopoietic neural membrane protein 1;
Gene ID 2014
mRNA Refseq NM_001425
Protein Refseq NP_001416
MIM 602335
UniProt ID P54852

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EMP3 Products

Required fields are marked with *

My Review for All EMP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon