Recombinant Full Length Human EMP3 Protein, GST-tagged

• Cat.No.: EMP3-4251HF
• Product Overview: Human EMP3 full-length ORF ( AAH09718, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 163 amino acids
• Description: The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Molecular Mass: 43.67 kDa
• AA Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMP3 epithelial membrane protein 3 [ Homo sapiens ]
• Official Symbol: EMP3
• Synonyms: EMP3; epithelial membrane protein 3; YMP; EMP-3; HNMP-1; hematopoietic neural membrane protein 1
• Gene ID: 2014
• mRNA Refseq: NM_001425
• Protein Refseq: NP_001416
• MIM: 602335
• UniProt ID: P54852